PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do025846.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 358aa    MW: 35594.3 Da    PI: 8.6691
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do025846.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3961122263
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                 kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Do025846.1  61 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 122
                 7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3157119IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3363119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05965119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MEEMLMAANA GAAANTGQGG SNPNPPAPAP SSVPGGGALR GGAPQAVAGA GSTERRARPQ  60
KEKALNCPRC NSTNTKFCYY NNYSLQQPRY FCKTCRRYWT EGGSLRNVPV GGGSRKNKRS  120
SSSSASASTS ASVTSSSMAS TAGAAPKNPK LAHEGAHDLN LAFPHHGGLH APEFSAFPSL  180
ESSSVCNSGG AMASNGRGGG GGAVPAVGAL SAMELLRSSG CYMPLQMPMP MPGDYAAAGF  240
ALGEFRAPPP PPPPSQSVLG FSLDAHGAGH GAAPAGYGSS AGLSENAGRL LFPFEDLKPP  300
VSSGGGGVAA GASGGASDGN SGHPQFDHHK EQGGGGPSAG HDTPGFWNGM IGGSGASW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824130.0KC582413.1 Sorghum bicolor dof20 protein (dof20) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976522.11e-157PREDICTED: dof zinc finger protein DOF4.6-like isoform X1
TrEMBLK3Y8A21e-156K3Y8A2_SETIT; Uncharacterized protein
STRINGSi010443m1e-156(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-42Dof family protein